PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 340aa    MW: 38529.9 Da    PI: 4.4833
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588928.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1860113356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++  +q+++Le+ Fe +++++ e++ +LA++lgL+ rqV +WFqNrRa++k
  XP_009588928.1  60 KKRRLRVDQVKALEKNFEVENKLDPERKVKLAQELGLQPRQVAIWFQNRRARWK 113
                     45578899*********************************************9 PP

2HD-ZIP_I/II127.46.1e-4159150192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl  +qvk+LE++Fe e+kL+perKv+la+eLglqprqva+WFqnrRAR+ktkqlE+dy++Lk+++d+lk++ e+L++++e+L +e+ 
  XP_009588928.1  59 EKKRRLRVDQVKALEKNFEVENKLDPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYNVLKANFDSLKHNYESLQHDNEALLKEIC 150
                     69*************************************************************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.74E-1950117IPR009057Homeodomain-like
PROSITE profilePS5007117.34655115IPR001356Homeobox domain
SMARTSM003891.3E-1758119IPR001356Homeobox domain
PfamPF000466.0E-1660113IPR001356Homeobox domain
CDDcd000861.78E-1660116No hitNo description
Gene3DG3DSA:1.10.10.601.8E-1963122IPR009057Homeodomain-like
PRINTSPR000318.9E-68695IPR000047Helix-turn-helix motif
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PRINTSPR000318.9E-695111IPR000047Helix-turn-helix motif
PfamPF021831.7E-16115155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MKRVRSSDSL GVPLMSMCQN TTDDHHQWNS QVYSRDFQSM LELGLDEEAC VEESGHGSEK  60
KRRLRVDQVK ALEKNFEVEN KLDPERKVKL AQELGLQPRQ VAIWFQNRRA RWKTKQLERD  120
YNVLKANFDS LKHNYESLQH DNEALLKEIC ELKSKQNGGN NESKADVKEE AIESETDDKY  180
IDQSKPNNST TLGNCEDDST ELNFESFNGG NGTINDSNIF ADFKDGSSDS DSSAILNEEN  240
SPNYAAISSS GAFLISNNGG SNSSSSNSSL NCFQFFDSNP KAILGDAKDK VFCNNQPQFV  300
KMEEHNFFSS EESCSTLFAD EQAPTLHWYC PEDWNNWKDS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107115RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754442e-87HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588928.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
RefseqXP_016500042.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLM1BEC01e-150M1BEC0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000432511e-149(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.16e-66homeobox protein 6